A apresentação está carregando. Por favor, espere

A apresentação está carregando. Por favor, espere

Profª Drª Adele Caterino-de-Araujo Instituto Adolfo Lutz de São Paulo

Apresentações semelhantes


Apresentação em tema: "Profª Drª Adele Caterino-de-Araujo Instituto Adolfo Lutz de São Paulo"— Transcrição da apresentação:

1 Profª Drª Adele Caterino-de-Araujo Instituto Adolfo Lutz de São Paulo
Características dos HTLV-1 e HTLV-2 em indivíduos infectados pelo HIV: tipos e subtipos prevalentes, origem e disseminação e dificuldades no diagnóstico laboratorial Profª Drª Adele Caterino-de-Araujo Instituto Adolfo Lutz de São Paulo

2 Mariana Cavalheiro Magri
Epidemiologia Molecular de HTLV-1 e HTLV-2 em pacientes coinfectados pelo HIV de São Paulo e de Londrina e região Mariana Cavalheiro Magri Tese de Doutorado Orientador: Adele Caterino de Araujo S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

3 Casuística Trinta e quatro amostras de DNA obtidas de pacientes infectados pelo HIV/Aids, provenientes de CRT-Aids de Londrina e região (BRLO): HTLV-1: 7 casos HTLV-2: 28 casos Trinta e quatro amostras de DNA obtidas de pacientes infectados pelo HIV/Aids, provenientes de CRT-Aids de São Paulo (BRSP), da rotina diagnóstica de infecção pelo HTLV do Centro de Imunologia do IAL: HTLV-1: 24 casos HTLV-2: 10 casos S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

4 Métodos Genoma proviral amplificado por PCR e nested PCR para as regiões LTR, env e tax do HTLV-1 e do HTLV-2 Detecção e purificação de produtos da PCR para sequenciamento Sequenciadores automáticos: ABI 3100 ou ABI 3130 Genetic Analyser (Applied Biosystems) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

5 Métodos S e m i n á r i o E s t a d u a l e m H T L V
Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

6 env LTR Árvores filogenéticas de HTLV-1 em coinfectados pelo HIV
S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

7 tax LTR Árvores filogenéticas de HTLV-1 em coinfectados HIV
S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

8 tax HTLV-1 em coinfectados pelo HIV
S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

9 tax HTLV-1 em coinfectados pelo HIV
Substituições de nucleotídeos C7401T e T7914C - 76,9% (exceção cluster B da América Latina) C7920T, C7982T, G8231A e A8367C - 100% Assinatura molecular Duas substituições de nucleotídeos C7982T e G8231A resultaram na trocas de aminoácido A2661V e S2744N - 100% Sequence Nucleotide change at position 7401 7410 7431 7476 7527 7593 7722 7908 7914 7920 7953 7974 7980 7982 8001 8002 8066 8109 8128 8184 8191 8231 8232 8288 8295 8313 8366 8367 ATK C G T A BRLO14-02 BRLO15-02 BRLO34-02 BRLO37-02 BRLO48-02 BRSP134-08 BRSP145-08 BRSP206-08 BRSP232-08 BRSP42-09 BRSP205-09 BRSP320-09 BRSP414-09 aa change AV TA TR VI SN EG RH S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

10 LTR HTLV-1 em coinfectados pelo HIV – Mutações em TRE-1 e TRE-2
S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

11 LTR HTLV-1 em coinfectados pelo HIV – Mutações em TRE-1 e TRE-2
Mutação G232A 16/24 ( 66.7% ) Dupla mutação G232A e A184G 13/24 ( 54.2% ) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

12 HTLV-1 em coinfectados pelo HIV
Análises filogenéticas confirmaram presença do subtipo HTLV-1a, subgrupo Transcontinental A. As sequencias agruparam em dois clusters da América Latina (cluster A e B), o que pode sugerir diferentes introduções do HTLV-1 no Brasil também nos indivíduos coinfectados pelo HIV. O alto grau de similaridade entre as sequencias permite especular sobre uma recente introdução do HTLV-1 no país. Todas as sequencias de HTLV-1 do estudo pertencem ao genótipo taxA e foi encontrada assinatura molecular, na tax, característica de isolados do Brasil. Mutações no TRE-1 e TRE-2 da LTR do HTLV-1 pode ter relação com evolução clínica ou apenas representar subtipo viral que circula no Brasil. S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

13 LTR Árvore filogenética de HTLV-2 em coinfectados pelo HIV
UDEV LTR UDEV Risco sexual S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

14 env tax Árvore filogenética de HTLV-2 em coinfectados pelo HIV
UDEV env tax Jundiaí-SP UDEV (HTLV-2c) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

15 HTLV-2 em coinfectados pelo HIV
Na região tax do HTLV-2, houve troca de nucleotídeo que resultou na perda do stop codon e o ganho de 25 aminoácidos, característica da Tax longa encontrada em isolados do Brasil. Análises filogenéticas confirmaram presença do subtipo HTLV-2a, variante -2c, em todas as amostras, exceto em uma que pertencia a paciente originário do Paraguai e resultou HTLV-2b. Especula-se que houve a transmissão do vírus dos índios para os UDEV das áreas urbanas, mas a descoberta de um grupo quase que exclusivamente de UDEV no presente estudo poderia representar uma via diferente de transmissão ou uma taxa evolutiva diferente da observada no grupo de exposição sexual. S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

16 Mapa das primeiras migrações humanas
Mapa das primeiras migrações humanas, de acordo com análises efetuadas no DNA mitocondrial (unidades: milênios até o presente) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

17 Experiência do Instituto Adolfo Lutz
Histórico do diagnóstico de infecção por HTLV-1/2 em indivíduos infectados pelo HIV Experiência do Instituto Adolfo Lutz S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

18 São Paulo (1991-1992) S e m i n á r i o E s t a d u a l e m H T L V
Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

19 São Paulo (1994) S e m i n á r i o E s t a d u a l e m H T L V
Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

20 São Paulo (2001-2004) ELISA 1ª, 2ª e 3ª G - 96/531 (18,1%)
Hemagen, Platelia, Ortho e Murex WB 2.4 Perfis de WB antes da soroconversão S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

21 Paraná (2002-2003) S e m i n á r i o E s t a d u a l e m H T L V
Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

22 São Paulo (2008) S e m i n á r i o E s t a d u a l e m H T L V n=1393
Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

23 São Paulo (2008) S e m i n á r i o E s t a d u a l e m H T L V
Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

24 São Paulo (2009) S e m i n á r i o E s t a d u a l e m H T L V
Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

25 PCR em tempo real (pol) - Taq Man® System (2010)
HTLV-1 HTLV-2 Albumina S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

26 Resultados com pacientes HIV/Aids
100 amostras HIV/Aids 33 HTLV-1/2 negativas por WB e PCR em tempo real (pol) 67 HTLV-1/2 positivas por WB e/ou PCR em tempo real (pol) 2 HTLV não tipado 62 HTLV-1/2 positivas por WB 54 HTLV-1/2 positivas por PCR em tempo real (pol) 5 WB indeterminado Todas confirmadas por sequenciamento 32 HTLV-1 28 HTLV-2 3 HTLV 28 HTLV-1 26 HTLV-2 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

27 WB vs. real-time PCR Parametros Western blotting PCR em tempo real
(pol) Resultado Qualitativo Semi-quantitativo Interpretação Visual Valor de Ct Equipamento necessário 2 1 Tempo de trabalho 3 h 2 h Tempo para o resultado 5 h 4 h Reagentes 1 amostra/tira 30 amostras/placa Custo por teste R$ 250,00 R$ 42,38 WB sensibilidade 92.5% PCR sensibilidade 80.6% S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

28 Custo / Benefício Custo-Benefício dos Algorítmos
   ALGORÍTMO A ALGORÍTMO B  Western Blot  Custo  PCR em tempo real  (n=100)  R$ ,00  R$  (n=38)  R$ 1.610,44  (n=46)  R$ ,00  Custo total  R$ ,44  R$ ,00 REDUÇÃO de CUSTO ≈ 41% USANDO ALGORITIMO B S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

29 Resultados indeterminados no WB devidos a:
Período de soroconversão Jacob et al., J Clin Virol 42 (2008) Imunosupressão do paciente com HIV/aids Morimoto et al., Rev Inst Med trop S Paulo 49 (2007) Olah et al., J Med Virol 82 (2010) Infecção com provírus HTLV defectivo ou com variantes de HTLV Caterino-de-Araujo, Rev Inst Adolfo Lutz 68 (2009) Costa e Segurado, J Clin Virol 44 (2009) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

30 Resultados negativos na PCR em tempo real devidos a :
Pequeno número de células infectadas por HTLV-1/2 e baixa carga proviral (principalmente por HTLV-2) Montanheiro et al., Virus Res 135 (2008) Flutuações na carga proviral durante a terapia antirretroviral Machuca and Soriano, JAIDS Journal of Acquired Immune Deficiency Syndromes 24 (2000) Os ensaios de PCR em tempo real e WB são complementares e necessários para o diagnóstico de HTLV-1/2 na Aids S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

31 Proposta de Algorítmo de testes laboratoriais para HTLV
Amostra de Sangue Plasma PBL TRIAGEM SOROLÓGICA EIA 3aG em duplicata ( - ) / ( - ) (+) / ( - ) (+) / (+) Resultado Negativo Repetir em duplicata (+) / ( - ) ou (+) / (+) PCR em tempo real Resultado Negativo Resultado Positivo DIAGNÓSTICO CONFIRMATÓRIO WB ResultadoNegativo Resultado Indeterminado Resultado Positivo Solicitar nova amostra S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

32 Vigilância e diagnóstico de infecção por HTLV-1 e HTLV-2 em indivíduos infectados pelo HIV
Adele Caterino-de-Araujo1, Alexandre de Almeida1, Cláudio T Sacchi1, Maria Gisele Gonçalves1, Luis F M Brígido2, Karoline R Campos2, Mariana C Magri3, Telma M Oshiro3, Maria Clara G G Ribeiro4, Leda F Jamal4, Maria Lucia R Mello4 1Centro de Imunologia, Instituto Adolfo Lutz 2Núcleo de Doenças de Transmissão Sanguínea e Sexual, Centro de Virologia, Instituto Adolfo Lutz 3Laboratório de Investigação Médica (LIM-47 e LIM-56), Hospital das Clínicas, Faculdade de Medicina da Universidade de São Paulo 4Centro de Referência e Treinamento DST/Aids (CRT-DST/Aids) da Coordenadoria de Controle de Doenças (CCD) da Secretaria de Estado da Saúde de São Paulo (CCD/SES-SP) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

33 INTRODUÇÃO Ano HTLV-1/2 ( %) HTLV-1 (%) HTLV-2 Local Ref. 1998 10,1
4,0 6,1 IIER, SP Caterino-de-Araujo et al., Diag Microbiol Infect Dis 1998, 30: 2001 13,4 6,0 7,4 CRT,Santos Etzel et al., JAIDS 2001, 26: 2007 5,8 3,3 2,5 SP Jacob et al., Rev. Inst. Med. trop. S. Paulo 2007, 49: 2009 4,7 0,6 4,1 RP (10,7%) SP (4,7%) Neto et al., Rev Soc Bras Med Trop 2009, 42: S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

34 Objetivos Conhecer a prevalência da infecção pelo HTLV-1 e HTLV-2 em pacientes soropositivos para o HIV em serviço especializado do estado de São Paulo; Pesquisar marcadores imunológicos e virológicos de valor diagnóstico e prognóstico na co-infecção HIV/HTLV-1 e HIV/HTLV-2; Contribuir para o desenvolvimento da vigilância desse agravo na população. S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

35 Delineamento experimental
1ª fase Estudo de corte transversal com 2000 pacientes (estimativa de 5% de casos soropositivos) Sorologia para HTLV por EIA e teste confirmatório de WB, INNOLIA e PCR em tempo real qualitativa 2ª fase Estudo longitudinal de dois anos com 100 pacientes soropositivos Coleta de sangue nos dias de retorno para quantificação de CD4+ e CV HIV (cerca de 3 ao ano, total 6 coletas) para PCR em tempo real quantitativa Subtipagem HIV, HTLV-1 e HTLV-2 em uma das amostras Tropismo HIV na primeira e última amostra de sangue Células T reg e perfil de citocinas em 15 pacientes virgens de tratamento e após HAART S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

36 Resultados esperados Determinar a real magnitude da infecção por HTLV em serviço especializado de HIV/Aids Estabelecer o melhor teste confirmatório para esta população Verificar se há flutuações de carga proviral de HTLV durante HAART Implantar a PCR em tempo real como auxiliar no diagnóstico e monitoramento Determinar subtipos prevalentes de HIV e HTLV na coinfecção Verificar se há variação de tropismo HIV durante seguimento de coinfectados Determinar se existe perfil característico de citocinas e de células T reg na coinfecção HIV/HTLV-1 e HIV/HTLV-2 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

37 Coinfecção por HIV-1, HTLV-1, HTLV-2 e HCV
37 anos, caucasiano, masculino, UDE 1997, Pneumonia por P jirovecii e sorologia positiva para HIV, iniciou HAART (DDI, 3TC, Nelfilavir) 2002, sorologia positiva para HCV e HTLV-1 e PCR positiva para HTLV-2 2005, lipodistrofia e vasculite periférica. HAART (DDI, 3TC, Lopinavir/Ritonavir) 2011 discreta esteatose hepática com enzimas e função hepática normais 2012 nova coleta de sangue para sorologia HTLV e tipagem HIV, HTLV-1 e HTLV-2 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

38 Valores de CD4, CD8 e carga viral de HIV
CD4 = 287/µL (170 a 441) CD8 = 805/µL (481 a 1090) CD4/CD8 = 0.39 (0.2 a 0.6) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

39 Resultados de WB p24 CS rgp46-I rgp46-II p53 p36 p32 p28 p26 p19 GD21 gp21 Negativo HTLV-1 HTLV-2 HTLV Indeterminado a Indeterminado b Indeterminado c HTLV-1 e HTLV-2 10 HTLV-1 HTLV-1 2002 2012 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

40 HTLV-1 env aa sequences and hot point sites
LO37 [GenBank JQ (2002), JX (2012)] aa144 EVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSIPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRRAVPVAVWLVSALAMGAGVAGGITGSMSLASGKSLLHEVDKDISQLTQAIVKNHKNLLKIA aa372 [Uniprot P23064, GenBank X56949] N glicosilação C – C ponte disulfeto G G V G G I G hot points de fusão [www.uniprot.org] S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

41 HTLV-2 env aa sequences and hot point sites
LO37 [GenBank JQ (2002), JX (2012)] aa163 APGYDPLWFITSEPTQPPPTPPPLVHDSDLEHVLTPSTSWTTKILKFIQLTLQSTNYSCMVCVDRSSLSSWHVLYTPNISIPQQTSSRTILFPSLALPAPPSQPFPWTHCYQPRLQAITTDNCNNSIILPPFSLAPVPPPATRRRRAVPIAVWLVSALAAGTGIAGGVTGSLSLASSKSLLLEVDKDISHLTQAIVKNHQNILRVAQYAAQNRRGLDLLFWEQGGLCKAIQEQCCFLNISNTHVSVLQERPPLEKRVITGWGLNWDLGLSQWAREALQTGITILALLLLVILFGPCILRQIQALPQRLQNRHNQYSLINPETML aa486 N glisosilação C – C ponte disulfeto AVPIAVWLVSALAAGTGIAGG sítio de fusão [Uniprot P0338, GenBank K02024] [www.uniprot.org] S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

42 PCR em tempo real (pol) para HTLV-1 e HTLV-2
2012 2002 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

43 tax LTR Árvores filogenéticas HTLV-1
S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

44 Árvores filogenéticas HTLV-2
0.01 BRSP84-09 BRSP130-09 BRSP171-08 BRSP172-08 BRSP348-08 BRLO03-02 BRLO02-02 BRLO12-02 BRLO21-02 BRLO25-02 BRLO39-02 BRLO22-02 BRLO26-02 BRLO05-02 BRLO09-02 BRLO28-02 BRLO10-02 BRLO35-02 BRLO49-02 BRSP160-08 UDI211 BRLO07-02 UDI72 BRLO19-02 BRLO43-02 BRLO18-02 SP4 BRLO37-02 SP2 BRLO24-02 BRSP91-08 BRSP111-08 BRLO32-02 BRLO45-02 SP WV BRSP239-08 BRLO29-02 BRLO11-02 BRLO27-02 UDI187 UDIRJ TIR525 TIRIYO22 TIRIYO26 SP319 08 RP329 BRLO23-02 NS291 UDI86 BH339 UDI81 IVDAROS GuyII KAY1 KAY2 k96 GU PortVs NRA 130P Gab BRLO38 FOR3 FOR2 PIL VIET32 G2 G12 Efe 0.01 SFIFU62 NOR2N ATL18 SMH1 SMH2 SFIFU55 PUEBRB Mo LA8A NAV DS OkInd158 IVDUros PH230PCAM Mexy17 GHKT Kayapo78 BRLO23-02 RP329 K96 BRLO09-02 BRLO21-02 BRLO12-02 BRLO28-02 BRLO22-02 BRLO31-02 BRSP171-08 BRSP84-09 BRSP130-09 SP281 BRBRLO26-02 BRSP348-08 BRSP239-08 Kayapo79 SP305 SP WV BRLO07 kayapo73 BRPOA5 BRPOA6 BRPOA12 SP17 SP510 BRPOA9 BRPOA8 BRLO27-02 BRSP160-08 Belem02 Belem10 BRAZA21 BRLO19-02 BRSP319-08 BRLO24-02 BRLO29-02 BRSP91-08 BRLO37-02 BRLO18-02 BH223 BH315 BH339 NRA Efe env LTR tax (HTLV-2c) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

45 Subtipagem e tropismo de HIV
Para a subtipagem de HIV foi amplificada a região de env viral de acordo com protocolo de Brígido et al., 2005. Usando a ferramenta NCBI-Genotyping os isolados dos anos 2002 e 2012 foram classificados como sendo do subtipo B. Para a determinação de tropismo foi seqüenciada a região variável do env de HIV que contém a região V3 loop (em triplicata), segundo protocolo de Ferreira et al., 2012. Usando a ferramenta Geno2pheno e um cut-off de 10%, os isolados de 2002 foram classificados como (X4) e os de 2012 como (R5) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

46 Comentários As infecções por HIV-1, HTLV-1, HTLV-2 e HCV são comuns em UDEV e causam infecção crônica no hospedeiro. As coinfecções HIV/HCV e HIV/HTLV-1 estão associadas a pior prognóstico das doenças à elas relacionadas, enquanto a coinfecção HIV/HTLV-2 parece estar associada a progressão mais lenta para Aids. O paciente com quadrupla infecção HIV,HTLV-1, HTLV-2 e HCV não produziu anticorpos anti-HTLV-2, tampouco apresentou co-morbidades associadas às infecções por HTLV-1 e HCV em seguimento de 10 anos. A análise comparativa dos isolados retrovirias dos anos de e 2012 mostrou sequencias idênticas dos HTLV-1/2 e troca de tropismo do HIV de CXCR4 (X4, linfotrópico, formador de sincício) para CCR5 (R5, monotrópico, não formador de sincício). S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

47 Comentários Foram encontrados os subtipos virais: HIV-1 subtipo B, HTLV-1 subtipo Cosmopolita a, subgrupo transcontinental A, e HTLV-2 subtipo -2a (variante -2c). Não foram detectadas mutações no envelope de HTLV-2 nem baixa carga proviral de HTLV-2, nas duas amostras de sangue e isto ressalta a importância da PCR para o diagnóstico de infecção por HTLV-2 em população HIV soropositiva. Apesar da intermitência HAART, as contagens de células CD4+, carga viral de HIV e função hepática estão sob controle neste paciente. Nós sugerimos um benefício da coinfecção HTLV-2 e a presença da variante R5 do HIV como responsáveis pelos achados clínicos deste paciente. Ainda, este paciente nos dá a oportunidade de conhecer as interações desses quatro vírus in vivo, e de avaliar o perfil de células T reguladoras e de citocinas na quadrupla infecção viral. S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

48 Obrigado! Profª Drª Adele Caterino-de-Araujo
Instituto Adolfo Lutz de São Paulo


Carregar ppt "Profª Drª Adele Caterino-de-Araujo Instituto Adolfo Lutz de São Paulo"

Apresentações semelhantes


Anúncios Google