A apresentação está carregando. Por favor, espere

A apresentação está carregando. Por favor, espere

Características dos HTLV-1 e HTLV-2 em indivíduos infectados pelo HIV: tipos e subtipos prevalentes, origem e disseminação e dificuldades no diagnóstico.

Apresentações semelhantes

Apresentação em tema: "Características dos HTLV-1 e HTLV-2 em indivíduos infectados pelo HIV: tipos e subtipos prevalentes, origem e disseminação e dificuldades no diagnóstico."— Transcrição da apresentação:

1 Características dos HTLV-1 e HTLV-2 em indivíduos infectados pelo HIV: tipos e subtipos prevalentes, origem e disseminação e dificuldades no diagnóstico laboratorial Profª Drª Adele Caterino-de-Araujo Instituto Adolfo Lutz de São Paulo

2 Epidemiologia Molecular de HTLV-1 e HTLV-2 em pacientes coinfectados pelo HIV de São Paulo e de Londrina e região S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Mariana Cavalheiro Magri Tese de Doutorado Orientador: Adele Caterino de Araujo

3 Casuística S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Trinta e quatro amostras de DNA obtidas de pacientes infectados pelo HIV/Aids, provenientes de CRT-Aids de Londrina e região (BRLO): HTLV-1: 7 casos HTLV-2: 28 casos Trinta e quatro amostras de DNA obtidas de pacientes infectados pelo HIV/Aids, provenientes de CRT-Aids de São Paulo (BRSP), da rotina diagnóstica de infecção pelo HTLV do Centro de Imunologia do IAL: HTLV-1: 24 casos HTLV-2: 10 casos

4 Métodos S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Genoma proviral amplificado por PCR e nested PCR para as regiões LTR, env e tax do HTLV-1 e do HTLV-2 Detecção e purificação de produtos da PCR para sequenciamento Sequenciadores automáticos: ABI 3100 ou ABI 3130 Genetic Analyser (Applied Biosystems)

5 Métodos S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

6 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 env LTR Árvores filogenéticas de HTLV-1 em coinfectados pelo HIV

7 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 LTR tax Árvores filogenéticas de HTLV-1 em coinfectados HIV

8 tax HTLV-1 em coinfectados pelo HIV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

9 tax HTLV-1 em coinfectados pelo HIV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Substituições de nucleotídeos C7401T e T7914C - 76,9% (exceção cluster B da América Latina) C7920T, C7982T, G8231A e A8367C - 100% Assinatura molecular Duas substituições de nucleotídeos C7982T e G8231A resultaram na trocas de aminoácido A2661V e S2744N - 100% Sequence Nucleotide change at position 740 1 741 0 743 1 747 6 752 7 759 3 772 2 790 8 791 4 792 0 795 3 797 4 798 0 798 2 800 1 800 2 806 6 810 9 812 8 818 4 819 1 823 1 823 2 828 8 829 5 831 3 836 6 836 7 ATKCCGTGCATTCCCTCAACAGCCGTAGTGA BRLO14-02TCTTTACC BRLO15-02ATTGAAC BRLO34-02TTGAAC BRLO37-02TGCTTGAC BRLO48-02TGCTTGAAC BRSP134-08TACCTTTACC BRSP145-08TCTTTAGC BRSP206-08TCTTTACC BRSP232-08TACTCTAAC BRSP42-09TCTTTACC BRSP205-09TCTTGAC BRSP320-09TCTTGGAAC BRSP414-09TCTTTAC aa change A VT AT RV IS NE GR H

10 LTR HTLV-1 em coinfectados pelo HIV – Mutações em TRE-1 e TRE-2 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

11 LTR HTLV-1 em coinfectados pelo HIV – Mutações em TRE-1 e TRE-2 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Mutação G232A 16/24 ( 66.7% ) Dupla mutação G232A e A184G 13/24 ( 54.2% )

12 HTLV-1 em coinfectados pelo HIV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Análises filogenéticas confirmaram presença do subtipo HTLV-1a, subgrupo Transcontinental A. As sequencias agruparam em dois clusters da América Latina (cluster A e B), o que pode sugerir diferentes introduções do HTLV-1 no Brasil também nos indivíduos coinfectados pelo HIV. O alto grau de similaridade entre as sequencias permite especular sobre uma recente introdução do HTLV-1 no país. Todas as sequencias de HTLV-1 do estudo pertencem ao genótipo taxA e foi encontrada assinatura molecular, na tax, característica de isolados do Brasil. Mutações no TRE-1 e TRE-2 da LTR do HTLV-1 pode ter relação com evolução clínica ou apenas representar subtipo viral que circula no Brasil.

13 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Árvore filogenética de HTLV-2 em coinfectados pelo HIV Risco sexual UDEV LTR

14 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 UDEV taxenv Jundiaí-SP UDEV Árvore filogenética de HTLV-2 em coinfectados pelo HIV (HTLV-2c)

15 HTLV-2 em coinfectados pelo HIV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Na região tax do HTLV-2, houve troca de nucleotídeo que resultou na perda do stop codon e o ganho de 25 aminoácidos, característica da Tax longa encontrada em isolados do Brasil. Análises filogenéticas confirmaram presença do subtipo HTLV-2a, variante -2c, em todas as amostras, exceto em uma que pertencia a paciente originário do Paraguai e resultou HTLV-2b. Especula-se que houve a transmissão do vírus dos índios para os UDEV das áreas urbanas, mas a descoberta de um grupo quase que exclusivamente de UDEV no presente estudo poderia representar uma via diferente de transmissão ou uma taxa evolutiva diferente da observada no grupo de exposição sexual.

16 Mapa das primeiras migrações humanas S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Mapa das primeiras migrações humanas, de acordo com análises efetuadas no DNA mitocondrial (unidades: milênios até o presente ) http://www.flickr.com/photos/

17 Histórico do diagnóstico de infecção por HTLV-1/2 em indivíduos infectados pelo HIV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Experiência do Instituto Adolfo Lutz

18 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 São Paulo (1991-1992)

19 São Paulo (1994) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

20 São Paulo (2001-2004) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Perfis de WB antes da soroconversão ELISA 1ª, 2ª e 3ª G - 96/531 (18,1%) Hemagen, Platelia, Ortho e Murex WB 2.4

21 Paraná (2002-2003) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

22 São Paulo (2008) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 n=1393

23 São Paulo (2008) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

24 São Paulo (2009) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012

25 PCR em tempo real (pol) - Taq Man® System (2010) S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 HTLV-1HTLV-2 Albumina

26 Resultados com pacientes HIV/Aids S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 33 HTLV-1/2 negativas por WB e PCR em tempo real (pol) Todas confirmadas por sequenciamento 2 HTLV não tipado 5 WB indeterminado 67 HTLV-1/2 positivas por WB e/ou PCR em tempo real (pol) 100 amostras HIV/Aids 54 HTLV-1/2 positivas por PCR em tempo real (pol) 28 HTLV-1 26 HTLV-2 28 HTLV-1 26 HTLV-2 62 HTLV-1/2 positivas por WB 32 HTLV-1 28 HTLV-2 3 HTLV 32 HTLV-1 28 HTLV-2 3 HTLV

27 WB vs. real-time PCR S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 ParametrosWestern blotting PCR em tempo real (pol) ResultadoQualitativoSemi-quantitativo InterpretaçãoVisualValor de Ct Equipamento necessário 21 Tempo de trabalho3 h2 h Tempo para o resultado5 h4 h Reagentes1 amostra/tira30 amostras/placa Custo por testeR$ 250,00R$ 42,38 WB sensibilidade 92.5% PCR sensibilidade 80.6%

28 Custo / Benefício S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 REDUÇÃO de CUSTO 41% USANDO ALGORITIMO B Custo-Benefício dos Algorítmos ALGORÍTMO AALGORÍTMO B Western Blot Custo PCR em tempo real Custo (n=100) R$ 25.000,00 (n=100) R$ 4.232.00 PCR em tempo real Western Blot (n=38) R$ 1.610,44 (n=46) R$ 11.500,00 Custo total R$ 26.610,44 R$ 15.738,00

29 Resultados indeterminados no WB devidos a: S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Período de soroconversão Jacob et al., J Clin Virol 42 (2008) 149-155. Imunosupressão do paciente com HIV/aids Morimoto et al., Rev Inst Med trop S Paulo 49 (2007) 225-230. Olah et al., J Med Virol 82 (2010) 837-842. Infecção com provírus HTLV defectivo ou com variantes de HTLV Caterino-de-Araujo, Rev Inst Adolfo Lutz 68 (2009) 182-186. Costa e Segurado, J Clin Virol 44 (2009) 185-189.

30 Resultados negativos na PCR em tempo real devidos a : S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Pequeno número de células infectadas por HTLV-1/2 e baixa carga proviral (principalmente por HTLV-2) Montanheiro et al., Virus Res 135 (2008) 22-25. Flutuações na carga proviral durante a terapia antirretroviral Machuca and Soriano, JAIDS Journal of Acquired Immune Deficiency Syndromes 24 (2000) 189-193. Os ensaios de PCR em tempo real e WB são complementares e necessários para o diagnóstico de HTLV-1/2 na Aids

31 Proposta de Algorítmo de testes laboratoriais para HTLV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 DIAGNÓSTICO CONFIRMATÓRIO TRIAGEM SOROLÓGICA Amostra de Sangue Plasma PBL EIA 3 a G em duplicata ( - ) / ( - ) (+) / ( - ) (+) / (+) Resultado Negativo Repetir em duplicata (+) / ( - ) ou (+) / (+) PCR em tempo real Resultado Positivo Resultado Negativo WB Resultado Positivo Resultado Negativo Resultado Indeterminado Solicitar nova amostra

32 Vigilância e diagnóstico de infecção por HTLV-1 e HTLV-2 em indivíduos infectados pelo HIV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Adele Caterino-de-Araujo 1, Alexandre de Almeida 1, Cláudio T Sacchi 1, Maria Gisele Gonçalves 1, Luis F M Brígido 2, Karoline R Campos 2, Mariana C Magri 3, Telma M Oshiro 3, Maria Clara G G Ribeiro 4, Leda F Jamal 4, Maria Lucia R Mello 4 1 Centro de Imunologia, Instituto Adolfo Lutz 2 Núcleo de Doenças de Transmissão Sanguínea e Sexual, Centro de Virologia, Instituto Adolfo Lutz 3 Laboratório de Investigação Médica (LIM-47 e LIM-56), Hospital das Clínicas, Faculdade de Medicina da Universidade de São Paulo 4 Centro de Referência e Treinamento DST/Aids (CRT-DST/Aids) da Coordenadoria de Controle de Doenças (CCD) da Secretaria de Estado da Saúde de São Paulo (CCD/SES- SP)

33 INTRODUÇÃO S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 AnoHTLV-1/2 ( %) HTLV-1 (%) HTLV-2 (%) LocalRef. 199810,14,06,1IIER, SP Caterino-de-Araujo et al., Diag Microbiol Infect Dis 1998, 30:173-182 200113,46,07,4CRT,Santos Etzel et al., JAIDS 2001, 26:185- 190 20075,83,32,5SP Jacob et al., Rev. Inst. Med. trop. S. Paulo 2007, 49:361-364 20094,70,64,1RP (10,7%) SP (4,7%) Neto et al., Rev Soc Bras Med Trop 2009, 42:264-270

34 Objetivos S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Conhecer a prevalência da infecção pelo HTLV-1 e HTLV-2 em pacientes soropositivos para o HIV em serviço especializado do estado de São Paulo; Pesquisar marcadores imunológicos e virológicos de valor diagnóstico e prognóstico na co-infecção HIV/HTLV-1 e HIV/HTLV-2; Contribuir para o desenvolvimento da vigilância desse agravo na população.

35 Delineamento experimental S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 1ª fase Estudo de corte transversal com 2000 pacientes (estimativa de 5% de casos soropositivos) Sorologia para HTLV por EIA e teste confirmatório de WB, INNOLIA e PCR em tempo real qualitativa 2ª fase Estudo longitudinal de dois anos com 100 pacientes soropositivos Coleta de sangue nos dias de retorno para quantificação de CD4+ e CV HIV (cerca de 3 ao ano, total 6 coletas) para PCR em tempo real quantitativa Subtipagem HIV, HTLV-1 e HTLV-2 em uma das amostras Tropismo HIV na primeira e última amostra de sangue Células T reg e perfil de citocinas em 15 pacientes virgens de tratamento e após HAART

36 Resultados esperados S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Determinar a real magnitude da infecção por HTLV em serviço especializado de HIV/Aids Estabelecer o melhor teste confirmatório para esta população Verificar se há flutuações de carga proviral de HTLV durante HAART Implantar a PCR em tempo real como auxiliar no diagnóstico e monitoramento Determinar subtipos prevalentes de HIV e HTLV na coinfecção Verificar se há variação de tropismo HIV durante seguimento de coinfectados Determinar se existe perfil característico de citocinas e de células T reg na coinfecção HIV/HTLV-1 e HIV/HTLV-2

37 Coinfecção por HIV-1, HTLV-1, HTLV-2 e HCV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 37 anos, caucasiano, masculino, UDE 1997, Pneumonia por P jirovecii e sorologia positiva para HIV, iniciou HAART (DDI, 3TC, Nelfilavir) 2002, sorologia positiva para HCV e HTLV-1 e PCR positiva para HTLV-2 2005, lipodistrofia e vasculite periférica. HAART (DDI, 3TC, Lopinavir/Ritonavir) 2011 discreta esteatose hepática com enzimas e função hepática normais 2012 nova coleta de sangue para sorologia HTLV e tipagem HIV, HTLV-1 e HTLV-2

38 Valores de CD4, CD8 e carga viral de HIV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 CD4 = 287/µL (170 a 441) CD8 = 805/µL (481 a 1090) CD4/CD8 = 0.39 (0.2 a 0.6)

39 Resultados de WB S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 p24 CS rgp46-I rgp46-II p53 p36 p32 p28 p26 p19 GD21 gp21 NegativoHTLV-1HTLV-2HTLVIndeterminado a Indeterminado b Indeterminado c HTLV-1 e HTLV-2 10 2002 2012 HTLV-1

40 HTLV-1 env aa sequences and hot point sites S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 EVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKL LTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSIPSSSSTPLLYPSLALPAPHLTLPFNWTHCF DPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRRAVPVAVWLVSALAMGAGVAGGITGSMSLAS GKSLLHEVDKDISQLTQAIVKNHKNLLKIA Nglicosilação C – Cponte disulfeto G G V G G I Ghot points de fusão LO37 [GenBank JQ435912 (2002), JX280961 (2012)] [Uniprot P23064, GenBank X56949] aa144 aa372 [www.uniprot.org]


42 PCR em tempo real (pol) para HTLV-1 e HTLV-2 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 20022012

43 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 LTR tax Árvores filogenéticas HTLV-1

44 Árvores filogenéticas HTLV-2 S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 0.01 BRSP84-09 BRSP130-09 BRSP171-08 BRSP172-08 BRSP348-08 BRLO03-02 BRLO02-02 BRLO12-02 BRLO21-02 BRLO25-02 BRLO39-02 BRLO22-02 BRLO26-02 BRLO05-02 BRLO09-02 BRLO28-02 BRLO10-02 BRLO35-02 BRLO49-02 BRSP160-08 UDI211 BRLO07 -02 UDI72 BRLO19-02 BRLO43-02 BRLO18-02 SP4 BRLO37-02 SP2 BRLO24-02 BRSP91-08 BRSP111-08 BRLO32-02 BRLO45-02 SP WV BRSP239-08 BRLO29-02 BRLO11-02 BRLO27-02 UDI187 UDIRJ TIR525 TIRIYO22 TIRIYO26 SP319 08 RP329 BRLO23-02 NS291 UDI86 BH339 UDI81 IVDAROS GuyII KAY1 KAY2 k96 GU PortVs NRA 130P Gab BRLO38 FOR3 FOR2 PIL VIET32 G2 G12 Efe env 0.01 SFIFU62 NOR2N ATL18 SMH1 SMH2 SFIFU55 PUEBRB Mo LA8A NAV DS OkInd158 IVDUros PH230PCAM Mexy17 GHKT Kayapo78 BRLO23-02 RP329 K96 BRLO09-02 BRLO21-02 BRLO12-02 BRLO28-02 BRLO22-02 BRLO31-02 BRSP171-08 BRSP84-09 BRSP130-09 SP281 BRBRLO26-02 BRSP348-08 BRSP239-08 Kayapo79 SP305 SP WV BRLO07 kayapo73 BRPOA5 BRPOA6 BRPOA12 SP17 SP510 BRPOA9 BRPOA8 BRLO27-02 BRSP160-08 Belem02 Belem10 BRAZA21 BRLO19-02 BRSP319-08 BRLO24-02 BRLO29-02 BRSP91-08 BRLO37-02 BRLO18-02 BH223 BH315 BH339 NRA Efe LTR tax (HTLV-2c)

45 Subtipagem e tropismo de HIV S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Para a subtipagem de HIV foi amplificada a região de env viral de acordo com protocolo de Brígido et al., 2005. Usando a ferramenta NCBI-Genotyping os isolados dos anos 2002 e 2012 foram classificados como sendo do subtipo B. Para a determinação de tropismo foi seqüenciada a região variável do env de HIV que contém a região V3 loop (em triplicata), segundo protocolo de Ferreira et al., 2012. Usando a ferramenta Geno2pheno e um cut-off de 10%, os isolados de 2002 foram classificados como (X4) e os de 2012 como (R5)

46 Comentários S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 As infecções por HIV-1, HTLV-1, HTLV-2 e HCV são comuns em UDEV e causam infecção crônica no hospedeiro. As coinfecções HIV/HCV e HIV/HTLV-1 estão associadas a pior prognóstico das doenças à elas relacionadas, enquanto a coinfecção HIV/HTLV-2 parece estar associada a progressão mais lenta para Aids. O paciente com quadrupla infecção HIV,HTLV-1, HTLV-2 e HCV não produziu anticorpos anti-HTLV-2, tampouco apresentou co-morbidades associadas às infecções por HTLV-1 e HCV em seguimento de 10 anos. A análise comparativa dos isolados retrovirias dos anos de 2002 e 2012 mostrou sequencias idênticas dos HTLV-1/2 e troca de tropismo do HIV de CXCR4 (X4, linfotrópico, formador de sincício) para CCR5 (R5, monotrópico, não formador de sincício).

47 Comentários S e m i n á r i o E s t a d u a l e m H T L V Rio de Janeiro – Brasil / 19 a 22 de setembro de 2012 Foram encontrados os subtipos virais: HIV-1 subtipo B, HTLV-1 subtipo Cosmopolita a, subgrupo transcontinental A, e HTLV-2 subtipo -2a (variante -2c). Não foram detectadas mutações no envelope de HTLV-2 nem baixa carga proviral de HTLV-2, nas duas amostras de sangue e isto ressalta a importância da PCR para o diagnóstico de infecção por HTLV-2 em população HIV soropositiva. Apesar da intermitência HAART, as contagens de células CD4+, carga viral de HIV e função hepática estão sob controle neste paciente. Nós sugerimos um benefício da coinfecção HTLV-2 e a presença da variante R5 do HIV como responsáveis pelos achados clínicos deste paciente. Ainda, este paciente nos dá a oportunidade de conhecer as interações desses quatro vírus in vivo, e de avaliar o perfil de células T reguladoras e de citocinas na quadrupla infecção viral.

48 Obrigado! Profª Drª Adele Caterino-de-Araujo Instituto Adolfo Lutz de São Paulo E-mail: caterino@usp.br, caterino@ial.sp.gov.br

Carregar ppt "Características dos HTLV-1 e HTLV-2 em indivíduos infectados pelo HIV: tipos e subtipos prevalentes, origem e disseminação e dificuldades no diagnóstico."

Apresentações semelhantes

Anúncios Google