" (maior que) seguido por Um código de duas letras descrevendo o tipo de sequência (P1, F1, DL, DC, RL, RC, or XX), seguido de Ponto e vírgulo, seguido de Código de identififcação da sequência. 2. Uma linha contendo uma descrição textual da sequência. 3. Uma ou mais linhas contendo a sequência. O fim da sequência é marcado por um asterisco (*)">

A apresentação está carregando. Por favor, espere

A apresentação está carregando. Por favor, espere

Paula Kuser Falcão Sequência da Proteína Busca em bancos de dados Definição de domínios Alinhamento múltiplo de sequências.

Apresentações semelhantes


Apresentação em tema: "Paula Kuser Falcão Sequência da Proteína Busca em bancos de dados Definição de domínios Alinhamento múltiplo de sequências."— Transcrição da apresentação:

1 Paula Kuser Falcão Sequência da Proteína Busca em bancos de dados Definição de domínios Alinhamento múltiplo de sequências Homólogo no PDB? Predição de Estrutura secundária Padrão de enovelamento Modelagem baseada em homologia Modelo da estrutura SIM NÃO Exercício Modelagem Structure Prediction Flowchart

2 Paula Kuser Falcão Formato FASTA 1.uma linha de descrição, seguida de linhas com os dados da sequência. A linha de descrição é diferenciada da linha de sequência por um símbolo ">“ na primeira coluna. 2.É recomendado que todas as linhas do texto tenham 80 caracteres ou menos. >gi|532319|pir|TVFV2E|TVFV2E envelope protein ELRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNG SYSENRTQIWQKHRTSNDSALILLNKHYNLTVTCKRPGNKTVLPVTIMAGLVF SQKYNLRLRQAWCHFPSNWKGAWKEVKEE IVNLPKERYRGTNDPK RIFFQRQWGDPETANLWFNCHGEFFYCKMDWFLNYLNNLTVDADHNECKNTSG TKSGNKRAPGPCVQRTYVACHIRSVIIWLETISKKTYAPPREGHLECTSTVTG MTVELNYIPKNRTNVTLSPQIESIWAAELDRYKLVEITPIGFAPTEVRRYTGG HERQKRVPFVXXXXXXXXXXXXXXXXXXXXXXVQSQHLLAGILQQQKNLLAAV EAQQQMLKLTIWGVK

3 Paula Kuser Falcão Formato PIR >P1;CRAB_ANAPL ALPHA CRYSTALLIN B CHAIN (ALPHA(B)-CRYSTALLIN). MDITIHNPLI RRPLFSWLAP SRIFDQIFGE HLQESELLPA SPSLSPFLMR SPIFRMPSWL ETGLSEMRLE KDKFSVNLDV KHFSPEELKV KVLGDMVEIH GKHEERQDEH GFIAREFNRK YRIPADVDPL TITSSLSLDG VLTVSAPRKQ SDVPERSIPI TREEKPAIAG AQRK* 1. Uma linha começando com: um sinal ">" (maior que) seguido por Um código de duas letras descrevendo o tipo de sequência (P1, F1, DL, DC, RL, RC, or XX), seguido de Ponto e vírgulo, seguido de Código de identififcação da sequência. 2. Uma linha contendo uma descrição textual da sequência. 3. Uma ou mais linhas contendo a sequência. O fim da sequência é marcado por um asterisco (*)

4 Paula Kuser Falcão Busca por Homologia em Bancos de Dados Exercício Abrir o arquivo texto com a sequência inicial em formato fasta. Abrir em Softwares o programa PsiBlast, e fazer uma busca por homologia da sequência inicial contra o banco de estruturas de proteínas. Clique com o mouse no campo “Enter sequence below”. Use o mouse para destacar a sequência no arquivo texto. Colocar a sequência no Blast fazendo copy & paste.

5 Paula Kuser Falcão Abrir o programa ClustalX. Obter as sequências dos 5 melhores hits do alinhamento e colocar num arquivo. Em ClustalX – Load Sequences, selecionar o arquivo onde estão as sequências. O resultado do alinhamento das sequências deve ser avaliado manualmente. Alinhamento - Clustal


Carregar ppt "Paula Kuser Falcão Sequência da Proteína Busca em bancos de dados Definição de domínios Alinhamento múltiplo de sequências."

Apresentações semelhantes


Anúncios Google