A apresentação está carregando. Por favor, espere

A apresentação está carregando. Por favor, espere

Função protéica (ou nanobiotecnologia sem criador) Prof. Dr. Francisco Prosdócimi.

Apresentações semelhantes


Apresentação em tema: "Função protéica (ou nanobiotecnologia sem criador) Prof. Dr. Francisco Prosdócimi."— Transcrição da apresentação:

1 Função protéica (ou nanobiotecnologia sem criador) Prof. Dr. Francisco Prosdócimi

2 Aula baseada no livro do Lehninger (Nelson e Cox) Capítulo 5 The cell – Cap 11

3 Hormônios protéicos Hormônios que são proteínas – Prolactina – Hormônio de crescimento (GH, HGH) – Hormônio adenocorticotrófico (ACTH) – Vasopressina – Oxitocina – Insulina – Somatostatina, etc. Todos esses hormônios viajam no sangue e precisam ser reconhecidos e incorporados em células específicas que são identificadas e reconhecidas através de receptores protéicos ligados às membranas celular

4 Cascatas de regulação Proteínas viajam no sangue até encontrar receptor de membrana Interações proteína- proteína e proteína-ligante regulam o metabolismo celular Acionadas por proteínas de membrana Reconhecem modificações no meio externo e modificam o ambiente intracelular em resposta

5 A estrutura dinâmica das proteínas Ligação reversível a outras moléculas: ligantes – Permite resposta rápida a modificações ambientais e condições metabólicas Sítio de ligação: interage com o ligante – Complementar em tamanho, forma, carga e afinidade à água A estrutura definida da proteína é como uma foto, na realidade a proteína opera de forma dinâmica

6 O Ligante e o encaixe induzido O sítio de ligação discrimina entre diferentes moléculas, ou seja, a interação é específica Uma proteína pode ter sítio de ligação para diversas moléculas Proteínas são flexíveis, vibram, respiram Mudanças conformacionais (alostéricas) são essenciais para a função protéica Encaixe induzido: adaptação estrutural da proteína que se liga firmemente a ele

7 Teoria do caos e estrutura de proteínas Novas teorias dizem que o modelo chave-e-fechadura está refutado A proteína fica em um estado de movimentação dinâmica razoavelmente caótico – É o substrato induz a mudança conformacional na proteína Complementaridade interativa: é como se a chave moldasse a fechadura ao encontrar com ela – ou vice-versa

8 Modificações conformacionais Em uma proteína contendo várias subunidades, uma mudança conformacional em uma delas normalmente afeta a conformação das demais As ligações com os ligantes podem ser reguladas por meio de interações específicas (fosforilação, glicosilação, etc.) ou por ligação a outros ligantes Nas enzimas, os ligantes são chamados substratos e o sítio de ligação é chamado sítio catalítico ou sítio ativo Palavras-chave: ligação, especificidade e mudança conformacional

9 Proteínas de ligação ao O 2 A mioglobina e a hemoglobina são provavelmente as proteínas mais estudadas do mundo – Primeiras a terem estrutura 3D conhecida – Reação reversível de ligação ao O 2 Por que uma proteína? – O 2 é pouco solúvel em solução aquosa (sangue)

10 Como ligar e transportar O 2 O problema: nenhuma cadeia lateral de aminoácido é adaptada a ligar uma molécula de oxigênio – Sabe-se que metais de transição (Ferro e cobre) ligam-se bem ao O 2, mas... – Ferro livre gera espécies reativas de oxigênio Grupo prostético: composto associado permanentemente a uma proteína e que contribui para sua função O grupo heme: anel de protoporfirina, seis ligações

11 A mioglobina 154 aa; Kda Encontrada no tecido muscular de mamíferos – Em focas e baleias guarda O 2 para mergulhos longos Globina (prot. globular) – 8 α-hélices – 78% dos resíduos Ligações proteína-ligantes são descritas por expressões de equilíbrio >gi| |ref|NP_ | myoglobin [Homo sapiens] MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIR LFKGHPETLEKFDKFKHLKSEDEMKASEDLKK HGATVLTALGGILKKKGHHEAEIKPLAQSHAT KHKIPVKYLEFISECIIQVLQSKHPGDFGADA QGAMNKALELFR KDMASNYKELGFQG P + L PL

12 Hemoglobina Proteína tetramérica quase esférica com 4 grupos heme – 2 cadeias alfa – 2 cadeias beta <50% de similaridade na cadeia primária!! – Estrutura 3D muito similar

13 Eritrócitos Eritrócitos são células altamente especializadas em transportar O 2 – Perderam núcleo, mito, retículo – Vivem 120 dias – 34% de seu peso total é de hemoglobina Hemoglobina está 96% saturada no sangue arterial e 64% no sangue venoso o CO tem mais afinidade à hemoglobina do que o O 2

14 Proteínas alostéricas Hemoglobina possui 2 tipos de estados conformacionais: T(enso) e R(elaxado) A ligação do O 2 à subunidade da hmb no estado T desencadeia mudança para o estado R Em proteínas alostéricas, como a Hmb, a interação com um ligante altera as propriedades de ligação a outros sítios da mesma proteína

15 A hemoglobina também carrega o CO 2 Liga CO 2 de forma inversamente proporcional quando relacionado à ligação com o oxigênio CO 2 liga-se como grupo carbamato ao grupo amino do aminoácido que está no N- terminal Os carbamatos formam pontes salinas adicionais que auxiliam na estabilização do estado T e provem liberação do O 2

16 A ligação do O2 à hmg é regulada por BPG 2,3 bisfosfoglicerato Presente em alta concentração nos eritrócitos Uma molécula ligada para cada hemoglobina – estabiliza o estado T – Dificulta a ligação do O 2 à hmg Quantidade de O 2 liberada nos tecidos é ~40% da quantidade máxima transportada no sangue – regulado com altitude Excesso de BPG => hipoxia Funcionamento inadequado do pulmão Feto tem hemoblogina que é mais afim de O 2 do que a da mãe

17 Anemia falciforme A mutação homozigota (aa) de um único nucleotídeo que codifica para a cadeia B da hemoglobina faz com que a forma da hemácea seja modificada – Não há cura, transporte ineficiente de O 2 Por outro lado, o heterozigoto (Aa) possui maior resistência à malária já que o Plasmodium não consegue infectar tão bem as hemáceas falciformes – Qual o tipo de tratamento que se dá à doenças genéticas?

18 Interações protéicas moduladas por energia química (ATP) Prof. Dr. Francisco Prosdocimi

19 Citoesqueleto Rede de filamentos protéicos que se prolongam no citoplasma Rede estrutural da célula – Define formato e organização geral do citoplasma Responsável pelos movimentos celulares – Transporte interno de organelas – Transporte de cromossomos na mitose Estrutura dinâmica – Organizado e desorganizado (divisão celular)

20 Composição do citoesqueleto Formados por três tipos principais de filamentos arranjados em conjunto e associados a organelas e à membrana por proteínas acessórias – Filamentos de Actina – Filamentos intermediários – Microtúbulos Funções – Motilidade celular, transporte de organelas, divisão celular e outros tipos de transporte celular FAFI MT

21 Filamentos do citoesqueleto Cada tipo de filamento do citoesqueleto é um polímero construído a partir de subunidades menores (monômeros) Podem difundir-se rapidamente pelo citoplasma Proteínas acessórias associam-se ao citoesqueleto Os polímeros do citoesqueleto são mantidos por ligações fracas (não covalentes)

22 Actina Proteína globular, principal proteína do citoesqueleto – 20% das proteínas totais de uma célula – Leveduras: um gene; Mamíferos: 6 genes Uma das proteínas mais conservadas sendo 90% idêntica desde os fungos até os mamíferos Usada frequentemente como controle negativo Quando polimerizada forma filamentos do citoesqueleto Participa da contração muscular, mobilidade celular, divisão celular, citocinese, movimentação de vesículas e organelas, sinalização celular, estabilização e manutenção das junções celulares, formato celular Interage com as membranas celulares

23 Filamentos de Actina Microfilamentos formam feixes ou redes tridimensionais com propriedades de géis semi-sólidos O arranjo e a organização dos filamentos, as ligações entre feixes e redes e estruturas celulares são regulados pela ligação com uma variedade de proteínas de associação com a actina Os filamentos são particularmente abundantes junto à membrana plasmática – Suporte mecânico e forma celular – Movimento da superfície celular

24 Microfilamentos de actina Cada monômero de actina faz uma rotação no filamento, que apresenta estrutura de hélice de dupla cadeia Possui uma polaridade que será importante para a definição do movimento da miosina Polimeriza espontaneamente em condições fisiológicas – Polimerização reversível (dinâmica) Extremidade positiva cresce de 5 a 10 vezes mais rápido do que a negativa

25 Organização dos filamentos Feixes de actina – Filamentos ligados em agrupamentos paralelos – Proteínas empacotadoras de actina Redes de actina – Arranjo ortogonal

26 Feixes paralelos Responsáveis pelas microvilosidades das membranas

27 Redes de actina Filamentos de actina ligados por proteínas filaminas Ligações ortogonais – Malha tridimensional frouxa Sustentação da superfície da célula

28 Adesão celular Responsáveis pelo contato com células adjacentes Fibras de estresse – Fibras de actina que promovem adesão celular Fibras de alfa-actinina ligam cateninas e caderinas Contato célula-célula – Junções de adesão

29 Projeções de membrana Microvilosidades intestinais Estruturas de resposta a estímulo – Formadas por formação e retração de feixes de actina Pseudópodos Microespículas

30 Resumo: filamentos de actina A: Microvilosidades B: feixes contráteis citoplasmáticos C: Protrusões em forma de lâmina e em forma de dedo D: Anel contrátil durante a divisão celular

31 Actina, miosina e o movimento celular Filamentos de actina estão associados a proteínas miosinas, responsável por movimentos celulares A miosina é motor molecular – Converte ATP em energia mecânica – Gera força e movimento Responsável pela contração muscular, divisão celular, movimentações celulares

32 Miosinas Reconhecidas originalmente como ATPases presentes em músculos lisos e estriados Conservadas na cabeça (liga actina e hidrolisa ATP), mas variáveis na cauda (interação com moléculas) Genoma humano possui aproximadamente 40 genes diferentes para miosinas Forma define a velocidade com a qual se deslocam nos feixes de actina

33 Contração muscular Especialização das células musculares Músculo como modelo para o estudo do movimento em nível celular e molecular Músculos – Estriado esquelético: movimentos voluntários – Estriado cardíaco: bombeia sangue do coração – Liso: movimentos involuntários do estômago, intestino, útero e vasos sanguíneos

34 Músculo esquelético São feixes de fibras musculares Citoplasma composto de miofibrilas – Filamento espessos de miosina – Filamentos finos de actina Sarcômeros – Cadeia de unidades contráteis

35 Sarcômeros Proteínas titinas – Ligam miosina da linha M até o disco Z Modelo do filamento deslizante (1954) – Contração do sarcômero – Aproximação dos discos Z – Banda A não sofre alteração – Bandas I e H desaparecem – Deslizamento dos filamentos de actina Linha M

36 O modelo do filamento deslizante As cabeças globulares da miosina ligam-se à actina – Ligação entre filamentos finos e espessos A miosina movimenta seus domínios globulares sobre os filamentos de actina em direção ao terminal positivo

37 Modelo da ponte pênsil Além de ligar-se à actina, as regiões globulares da miosina ligam-se e hidrolisam o ATP, que fornece a energia para a realização do deslizamento Deslizamento dos feixes de miosina sob os feixes de actina

38 Miosinas não-convencionais Não formam filamentos Envolvidas em outros tipos de movimentos celulares – Transporte de vesículas e organelas – Fagocitose, emissão de pseudópodos Caudas se ligam a organelas Movimentação sob o esqueleto de actina

39 Microtúbulos Cilindros ocos de 25nm de diâmetro Estruturas dinâmicas em constante processo de organização e desorganização Definem a forma da célula Promovem locomoção, transporte intracelular de organelas e separação dos cromossomos durante a mitose

40 Tubulina Proteína globular Arranjos das formas alfa e beta formam os microtúbulos

41 Estrutura dos microtúbulos Formado por dímeros de tubulinas alfa e beta Formados por 13 filamentos lineares organizados em volta do centro do túbulo Assim como os filamentos de actina são estruturas polares – Extremidade positiva: crescimento rápido – Extremidade negativa: crescimento lento A polaridade interfere na direção do movimento ao longo do microtúbulo

42 Instabilidade dinâmica Tubulina ligada a GTP é incorporada ao microtúbulo A adição de tubulina-GTP ocorre mais rápido do que a hidrólise do GTP -> formação de cap GTP Na falta de moléculas de GTP ligadas a tubulina, a hidrólise ocorre de forma mais rápida e o complexo é despoli- merizado Remodelamento dos microtúbulos é impor- tante na mitose

43 Microtúbulos, drogas e câncer Drogas que se ligam à tubulina, como a colchicina e a colcemida inibem a polimerização de microtúbulos Inibem assim a divisão celular (mitose) Outras drogas que se ligam aos microtúbulos são também utilizadas no tratamento de câncer, como vincristina e vimblastina

44 Centríolo, centrossomo e organização dos microtúbulos Microtúbulos se estendem a partir de um centro organizador de microtúbulos – O centrossomo se localiza junto ao núcleo Durante a mitose os centrossomos formam os fusos mitóticos, responsáveis pela separação dos cromossomos nas células filhas

45 Centrossomos Formados por um par de centríolos organizados perpendicularmente, circundados pelo material peri- centriolar Centríolo: estrutura cilíndrica formada por 9 tripletes de microtúbulos Funções de organização dos microtúbulos pelo centrossomo

46 Organização dos microtúbulos na mitose Organização do fuso mitótico: responsável pela separação dos cromossomos homólogos Centríolo e componentes do centrossomo são inicialmente duplicados Os dois centrossomos são então localizados em cada um dos lados do núcleo Na mitose ocorre despolimerização e retração geral dos microtúbulos

47 Microtúbulos motores e movimentos Responsáveis por movimentos celulares, transporte intracelular, posicionamento de vesículas e organelas, separação dos cromossomos, batimento de cílios e flagelos Assim como no caso da actina a movimentação é realizada por proteínas motoras que usam a energia do ATP Cinesinas e dineínas fazem aqui o papel da miosina

48 Cinesinas e dineínas Movem-se em direções opostas ao longo dos microtúbulos – Cinesina: move-se para a extremidade positiva – Dineína: extremidade negativa Cerca de 100 diferentes cinesinas em humanos

49 Transporte de organelas Neurônios com metros de comprimento precisam ter moléculas transportadas para o axônio Vesículas secretoras vindas do Golgi são transportadas ao longo dos microtúbulos aos axônios

50 Separação dos cromossomos mitóticos Ocorre durante a anáfase Anáfase A – Movimento dos cromossomos em direção ao polo do fuso Anáfase B Separação dos polos do fuso

51 Cílios e Flagelos Projeções de membrana formadas por microtúbulos e responsáveis pelo movimento de células eucarióticas Flagelos de bactérias são protéicos (não tubulina) Estrutura em axonema (9+2)

52 Sistema imunológico Prof. Dr. Francisco Prosdocimi

53 Proteínas e imunologia A maioria das interações proteína-ligante não envolve grupo prostético Discriminação efetiva do ligante é na forma de sítio de ligação proteína-proteína Resposta imunológica – A distinção molecular entre próprio e não-próprio – Teoria de rede – O sistema homeostático bioquímica é altamente sensível e desenvolvido através das reações entre ligantes e proteínas

54 Sistemas imunológicos Imunidade celular – Células hospedeiras infectadas por vírus, parasitas e tecidos estranhos – Linfócitos T Parasitas possuem receptores de células Tc Células T auxiliares produzem proteínas sinalizadoras (citocinas) Imunidade humoral – Infecções bacterianas e virais, proteínas estranhas – Anticorpos ou imunoglobulinas (Ig) – 20% das proteínas do sangue são Igs produzidas pelos linfócitos B

55 Proteínas imunológicas Proteínas de reconhecimento altamente específicas (humanos teem 10 8 anticorpos com especificidades diferentes) – Receptor de célula T – Anticorpo produzido por célula B Antígeno: molécula que induz resposta imunológica – Epitopo: determinante antigênico, região da molécula reconhecida Imunoglobulinas (igs): formadas por 4 cadeias polipeptídicas, sendo 2 pesadas e 2 leves

56 Imunoglobulinas Ligação específica entre antígeno e anticorpo Imunoglobulinas podem ser encontradas em monômeros, dímeros, trímeros, multímeros Marcação do patógeno para engolfamento por macrófagos

57 Ligação antígeno-anticorpo Firme e específica É a base para procedimen-tos analíticos importantes Anticorpo – policlonal: reconhecido por várias células B diferentes – Monoclonal: reconhecidos pela mesma população de células B Anticorpo pode ser ligado a uma resina cromatográfica para separação de uma proteína específica Exames sorológicos: detecta presença e quantidade do antígeno Immunoblot

58 Conclusões As proteínas teem inúmeras funções celulares A estrutura da proteína é altamente relevante para que ela tenha uma função celular O contato proteína-proteína regula muitas funções intra e intercelulares (receptores de membrana) As proteínas mudam de conformação quando encaixadas a um ligante – A ligação reversível da proteína ao ligante é importante na regulação do metabolismo – Sítios de ligação podem ligar diferentes moléculas, algumas com mais afinidade do que o ligante desejado Proteínas interagem para a formação do citoesqueleto e contração muscular, gastando energia química Polimeração e despolimerização de complexos poliméricos acontecem em todo o instante nas células Proteínas podem ligar moléculas indiretamente -- através de grupos prostéticos Há um controle dos ligantes mais comuns dentro de um organismo e a presença de novas moléculas desconhecidas aciona o sistema imune

59 Aula baseada no livro do Lehninger (Nelson e Cox) Capítulo 5 The cell – Cap 11


Carregar ppt "Função protéica (ou nanobiotecnologia sem criador) Prof. Dr. Francisco Prosdócimi."

Apresentações semelhantes


Anúncios Google