A apresentação está carregando. Por favor, espere

A apresentação está carregando. Por favor, espere

1 Ignez Caracelli BioMat – DF – UNESP/Bauru Bauru, 17 de agosto de 2009. Aula 1 Introdução ao Curso Representação das Moléculas Aminoácidos Aminoácidos.

Apresentações semelhantes


Apresentação em tema: "1 Ignez Caracelli BioMat – DF – UNESP/Bauru Bauru, 17 de agosto de 2009. Aula 1 Introdução ao Curso Representação das Moléculas Aminoácidos Aminoácidos."— Transcrição da apresentação:

1 1 Ignez Caracelli BioMat – DF – UNESP/Bauru Bauru, 17 de agosto de Aula 1 Introdução ao Curso Representação das Moléculas Aminoácidos Aminoácidos Introdução a Bioquímica: Biomoléculas Julio Zukerman Schpector LaCrEMM – DQ – UFSCar

2 Avaliação 1seminário em grupo (S) 1 prova (P) atividades (A) média (M) M = 0,4 S + 0,6 P + A 2

3 Avaliação - Conceitos M = 0,4 S + 0,6 P + A 3 6 M 7,0 conceito C 7,1 M 8,5 conceito B 8,6 M 10,0 conceito A

4 s envio e entrega de material e exercícios urgente: 4

5 Sites (disponibilização de material) ou disciplinas BIT603 5

6 Ementa proteínas DNA. lipídeos. açúcares. enzimas. o que está acontecendo… 6

7 Ementa 7 bioquímica estrutural bioquímica estrutural

8 Ferramentas programas de visualização gráfica bancos de dados conhecimentos de química conhecimentos de bioquímica conhecimentos de interações, ligações 8

9 9 Referência Autores Autores: Ignez Caracelli e Julio Zukerman-Schpector Editora Editora: EdUFSCar ISBN: ISBN:

10 Principais Referências Lehninger Voet & Voet Voet, Voet & Pratt 10

11 11 Bancos de Dados PDB PDBSum NDB finder/index.html

12 IC12 Estrutura Sistemas Biológicos métodos experimentais espectroscopia UV-visível espectroscopia Raman espectroscopia IV dicroísmo circular ressonância paramagnética eletrônica (EPR) ressonância magnética nuclear (NMR) difração de raios X métodos teóricos modelagem por homologia docking dinâmica molecular alinhamento de seqüências

13 IC13 Estrutura Ferramentas Computacionais métodos experimentais difração de raios X métodos teóricos modelagem por homologia docking dinâmica molecular alinhamento de seqüências

14 Estrutura Ferramentas Computacionais métodos experimentais difração de raios X cristal fonte de raios X sistema de detecção padrão de difração

15 IC15 Estrutura Ferramentas Computacionais métodos teóricos modelagem por homologia docking dinâmica molecular alinhamento de seqüências

16 IC16 Desafios do século XX problemas dos sistemas não-vivos– condutores, supercondutores, novos materiais, energia, radiações, comunicações,.... envolvidos: física, química, matemática, computação, engenharias,...

17 IC17 Desafios do século XXI problemas dos sistemas biológicos envolvidos: física, química, matemática, computação, engenharias,... + biologia, bioquímica, genética, fisiologia,...

18 IC18 Desafios dos séculos XX e XXI Genoma: Genoma: estuda a molécula de DNA e a informação nela armazenada sob a forma de genes. Transcriptoma: Transcriptoma: a transcrição do DNA para o RNA, o primeiro passo do fluxo da informação genética, para que seja possivel ter uma idéia da funcionalidade do genoma daquela célula. Proteoma: Proteoma: as proteínas expressas são analisadas e identificadas Metaboloma: Metaboloma: visa determinar os metabólitos, os produtos finais dos diversos processos celulares e que podem englobar, além dos nucleotídeos e aminoácidos, os açúcares, lipídios, esteróides e mais uma infinidade de outras moléculas importantes para a manutenção da atividade biológica.

19 IC 19 Desafios do século XXI genes genes

20 IC20 Desafios do século XXI Interactoma: estudo das interações proteína- proteína, proteína - dna, proteína- moléculas pequenas,….

21 Moléculas 21

22 Moléculas 22

23 Moléculas 23

24 Moléculas 24 x x y y z z átomo

25 IC25 Estrutura tridimensional = conhecer as coordenadas de todos os átomos

26 26 Linguagem x Informação letras frases aminoácidosaminoácidosproteínasproteínas

27 27 Problema Central frases texto proteínasproteínasfunçãofunção

28 28 Estruturas tridimensionais métodosexperimentais métodosteóricos

29 29 Estruturas tridimensionais moléculaspequenas moléculasgrandes

30 30 Estruturas Tridimensionais métodos experimentais: cristal

31 31 Estruturas Tridimensionais difração de raios X cristalografia

32 32 1 conformação planejada conformação dobrada cristalografia planejamento moléculas pequenas síntese Estruturas Tridimensionais

33 33 1 conformação planejada 1 conformação não-planejada conformação estendida conformação dobrada HC05 HC05 cristalografia planejamento moléculas pequenas síntese Estruturas Tridimensionais

34 34 Estruturas Tridimensionais proteínas

35 35 Estruturas Tridimensionais quem são as proteínas??? como são suas estruturas 3D?? como desempenham suas funções???

36 36 Estruturas Tridimensionais in silico Modelagem Molecular alinhamento de seqüências predição de estruturas de proteínas modelagem por homologia modelagem de ligantes docking

37 Proteínas 37

38 IC38 Funções biológicas das proteínas Biocatalizadores (enzimas) Receptores de sinais químicos Transportadores Estruturais (citoesqueleto, colágeno) Defesa (sistema imunológico, restrição bacteriana, etc.) Mobilidade (motores moleculares) Transdução Aderência celular e organização tissular Enovelamento correto de outras proteínas Outras

39 39 Os aminoácidos e proteínas proteína O químico holandês Gerardus Mulder foi o primeiro a dotar o termo proteína em Do grego proteus: primário, o mais importante.

40 40 Os aminoácidos e proteínas asparagina O primeiro aminoácido descoberto foi a asparagina, extraída do aspargo, em leucina O primeiro identificado em uma proteína foi a leucina por Proust em o treonina O último (20 o )a ser descoberto foi a treonina em (hoje isto nao é mais verdade…)

41 41 Os aminoácidos e proteínas Os aminoácidos não possuem um nome sistemático. glicina A glicina tem esse nome devido ao gosto doce (glycos = doce). tirosina A tirosina foi originalmente isolada do queijo (tyros = queijo). ácido glutâmico O ácido glutâmico foi encontrado no glúten de trigo.

42 42 Aspectos Básicos da Estrutura Polipeptídica As proteínas são cadeias (polímeros) constituídos por ligações peptídicas22 L-aminoácidos-padrão unidos por ligações peptídicas Os aminoácidos reunem-se em combinações praticamente infinitas

43 43 Níveis estruturais das proteínas estrutura primária estrutura secundária estrutura terciária estruturaquaternária próxima aula...

44 44 Aspectos Básicos da Estrutura Polipeptídica As proteínas são cadeias (polímeros) constituídas por 22 L-aminoácidos D-açúcares

45 45 Grupo carboxila (dissociado) Grupo amina (protonado) Cadeialateral Carbono Carbono R Aminoácidos

46 46 Ligações nas Proteínas interações covalentesinterações covalentes (fortes) –ligação peptídica (aa – aa) –ligacao dissulfeto (S – S; Cys – Cys) interações não-covalentesinterações não-covalentes (fracas) –interações eletrostáticas –interações de van der Waals –ligações de hidrogênio –interações hidrofóbicas

47 IC47 1 o nível estrutural: Estrutura Polipeptídica – seqüência de aminoácidos (formação da cadeia) polipeptídeos Proteínas são polipeptídeos constituídos por: 22 L-aminoácidos D-açúcares

48 IC48 Letras palavras ABCDCDEFGHIJKLMNOPQRSTUVWXYZ ACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWY ABCORSCOBRAS

49 IC49 aminoácidos proteínas K L P A S F D A R E Q W P GLN CYS PRO THR ILE LYS GLU ILE ARG ASP GLN GLY SER CYS GLY SER CYS TRP ALA PHE GLY ALA VAL GLU ALA ILE SER ASP ARG ILE CYS ILE HIS THR ASN ALA HIS VAL SER VAL GLU VAL SER ALA GLU ASP LEU LEU THR CYS CYS GLY SER MET CYS GLY ASP GLY CYS ASN GLY GLY TYR PRO ALA GLU ALA TRP ASN PHE TRP THR ARG LYS GLY LEU VAL SER GLY GLY LEU TYR GLU SER HIS VAL GLY CYS ARG PRO TYR SEQRES 9 A 261 SER ILE PRO PRO CYS GLU HIS HIS VAL ASN GLY SER ARG SEQRES 10 A 261 PRO PRO CYS THR GLY GLU GLY ASP THR PRO LYS CYS SER SEQRES 11 A 261 LYS ILE CYS GLU PRO GLY TYR SER PRO THR TYR LYS GLN SEQRES 12 A 261 ASP LYS HIS TYR GLY TYR ASN SER TYR SER VAL SER ASN SEQRES 13 A 261 SER GLU LYS ASP ILE MET ALA GLU ILE TYR LYS ASN GLY SEQRES 14 A 261 PRO VAL GLU GLY ALA PHE SER VAL TYR SER ASP PHE LEU SEQRES 15 A 261 LEU TYR LYS SER GLY VAL TYR GLN HIS VAL THR GLY GLU SEQRES 16 A 261 MET MET GLY GLY HIS ALA ILE ARG ILE LEU GLY TRP GLY SEQRES 17 A 261 VAL GLU ASN GLY THR PRO TYR TRP LEU VAL ALA ASN SER SEQRES 18 A 261 TRP ASN THR ASP TRP GLY ASP ASN GLY PHE PHE LYS ILE SEQRES 19 A 261 LEU ARG GLY GLN ASP HIS CYS GLY ILE GLU SER GLU VAL SEQRES 20 A 261 VAL ALA GLY ILE PRO ARG THR ASP GLN TYR TRP GLU LYS SEQRES 21 A 261 ILE

50 IC50 aminoácidos proteínas KRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWP QCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNA HVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWT RKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCT GEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNS EKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVT GEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDN GFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

51 51 Ligação Peptídica

52 IC52 Aminoácidos Grupo carboxila (dissociado) Grupo amina (protonado) Cadeialateral Carbono Carbono R

53 IC53 Aminoácidos: estereoisomeria

54 IC54 Isômeros Óticos molécula quiral Uma molécula quiral, é aquela que não é idêntica à sua imagem especular. enantiômeros Uma molécula quiral e sua imagem especular formam um par de enantiômeros, ou isômeros especulares.

55 IC55 Isomeria Ótica: Polarímetro substância a ser analisada polarizador lâmpada de sódio (monocromática amarela) luz polarizada desvio da luz

56 IC56 Isomeria Ótica: Polarímetro luz polarizada substância analisada não muda a rotação do discoinativa gira o disco para a direita oticamente ativaD oticamente ativa : dextrógira D girar o disco para a esquerda oticamente ativa oticamente ativa : levógira L

57 IC57 Isômeros Óticos: exemplo Talidomida 1953 – empresa suíça Ciba 1954 – empresa alemã Chemie Gruenenthal (testes mal conduzidos) prescrito para convulsões epilépticas (inefetivo)

58 IC58 Isômeros Óticos: exemplo Talidomida ensaios clínicos como um novo antihistamínico como tratamento da alergia (inefetivo)

59 IC59 Isômeros Óticos: exemplo Talidomida ensaios clínicos como um novo antihistamínico como tratamento da alergia (inefetivo) efetivo como sedante

60 IC60 Isômeros Óticos: exemplo Talidomida efetivo como sedante o destino definitivo do fármaco foi para tratar náuseas, ansiedade, insônia e vômitos matutinos das grávidas.

61 IC61 Isômeros Óticos: exemplo Talidomida Três anos más tarde, em 1957, a talidomida se converteu no medicamento para ajudar as grávidas. Seu uso se estendeu rapidamente e em 1958 foi introduzido em vários países da Europa, África, América e também na Austrália.

62 IC62 Isômeros Óticos: exemplo Talidomida 1956

63 IC63 Isômeros Óticos: exemplo Talidomida obstetra australiano, William McBride focomielia uma rara enfermidade congênita em que há desenvolvimento incompleto (total ou parcial) de pernas e braços. também apareciam outras anomalias menos raras em outros recém nascidos: surdez, cegueira, má formação de órgãos,....

64 IC64 Isômeros Óticos: exemplo Talidomida enantiômero R enantiômero S SR centro quiral

65 IC65 Isômeros Óticos: exemplo Talidomida S efeito sedativo Talidomida R efeito teratogênico agente teratogênicoagente teratogênico tudo aquilo capaz de produzir dano ao embrião ou feto durante a gravidez.

66 IC66 Isômeros Óticos: exemplo Talidomida S efeito sedativo Talidomida R efeito teratogênico agente teratogênicoagente teratogênico tudo aquilo capaz de produzir dano ao embrião ou feto durante a gravidez.

67 IC67 Isômeros Óticos: exemplo Talidomida R efeito teratogênico agente teratogênicoagente teratogênico tudo aquilo capaz de produzir dano ao embrião ou feto durante a gravidez. HOJE existem provas da sua eficácia em doenças como a lepra (apoiados pela OMS). Pode ser encontrado à venda na Internet, mas este tipo de venda é totalmente fraudulenta.

68 IC 68 Isômeros Óticos: exemplo Talidomida R efeito teratogênico agente teratogênicoagente teratogênico tudo aquilo capaz de produzir dano ao embrião ou feto durante a gravidez. HOJE Ensaios estão também em curso com talidomida e de alguns dos seus derivados em certos tipos de pacientes com câncer. Ficou provado ser eficaz em casos de mieloma múltiplo, especialmente aplicada nos casos em que os tratamentos convencionais (quimioterapia e radioterapia) falharam ou não são viáveis. Em alguns casos, a talidomida tem eficácia terapêutica convencional.

69 IC 69 Isômeros Óticos: exemplo Ibuprofeno O 'ibuprofeno' é um fármaco do grupo dos anti-inflamatórios não esteróides(AINE), utilizado freqüentemente para o alívio sintomático da dor de cabeça (cefaleia), dor dentária, dor muscular (mialgia), moléstias da menstruação (dismenorreia), febre e dor pós- cirúrgica. Também é usado para tratar quadros inflamatórios, como os que apresentam-se em artrites, artrite reumatóide (AR) e artrite gotosa.anti-inflamatórios não esteróidescefaleiamialgiadismenorreiaartrite reumatóideartrite gotosa (S)-(+)-ibuprofen (dexibuprofen) :dexibuprofen a forma ativa in vitro e in vivo. R S

70 IC 70 Isômeros Óticos: exemplo Ibuprofeno (S)-(+)-ibuprofen (dexibuprofen) :dexibuprofen a forma ativa in vitro e in vivo. R S

71 Fármacos vai onde? o que vai fazer? de onde veio?

72 onde foi parar?

73

74 IC74 aminoácidos C H O N P S Se outros.... quais?

75 Arquivo texto da proteina PDB – Protein Databank IC75

76 Arquivo texto da proteina 1mbn IC76


Carregar ppt "1 Ignez Caracelli BioMat – DF – UNESP/Bauru Bauru, 17 de agosto de 2009. Aula 1 Introdução ao Curso Representação das Moléculas Aminoácidos Aminoácidos."

Apresentações semelhantes


Anúncios Google