A apresentação está carregando. Por favor, espere

A apresentação está carregando. Por favor, espere

A técnica da Eletroforese para a análise de DNA e proteínas Prof. Dr. Francisco Prosdocimi.

Apresentações semelhantes


Apresentação em tema: "A técnica da Eletroforese para a análise de DNA e proteínas Prof. Dr. Francisco Prosdocimi."— Transcrição da apresentação:

1 A técnica da Eletroforese para a análise de DNA e proteínas Prof. Dr. Francisco Prosdocimi

2 Histórico 1952, Markham and Smith – Ao estudarem hidrólise de RNA percebem que moléculas de diferentes estruturas têm sua mobilidade diferenciada quando aplicadas num papel e submetidas a um campo elétrico 1955, Smithies – Géis de amido funcionam bem para separar proteínas do soro humano 1967, Loening – Géis de acrilamida com maior resolução e permitem separar ainda moléculas grandes de DNA 1980, Schwartz and Cantor – Eletroforese em campo pulsado separa fragmentos enormes É hoje impossível imaginar um laboratório de biomol sem eletroforese acontecendo a todo instante... Vou ali correr um gelzinho e já volto Tenho que ir senão vou perder meu gel

3 Eletroforese Movimento de partículas dispersas num fluído sob influência de um campo elétrico uniforme DNA, carga negativa – Tem tendência a se dirigir ao polo positivo quando sujeito a um campo elétrico Serve para separar moléculas por tamanho/carga elétrica – Proteína deve ser desnaturada com detergente (SDS) Técnica utilizada à exaustão em trabalhos de biologia molecular

4 Eletroforese, etapas 1.Preparação do gel 2.Aplicação das amostras 3.Eletroforese 4.Coloração 5. Análise dos resultados

5 Preparação do gel Horizontal X Vertical Agarose X Poliacrilamida

6 Aplicação das amostras Definição do mapa das amostras por canaleta

7 Corrida do gel Aplicação do campo elétrico Fonte elétrica gera fluxo de íons através da solução tampão Terminais positivo e negativo Tempo adequado, senão o DNA sai do gel

8 Coloração das moléculas Brometo de etídio – Agente intercalante do DNA Cancerígeno! – Composto fluorescente à luz UV – Gel de agarose Prata – Gel SDS-PAGE PoliAcrilamide Gel Electrophoresis – Melhor resolução Coomassie blue, etc

9

10

11 Eletroforese em campo pulsado Grandes fragmentos de DNA

12 PCR a reação em cadeia da polimerase Prof. Dr. Francisco Prosdocimi -927b e95-18a92a9e95a5

13 Reação em cadeia

14 Amplificação do DNA

15 Síntese de DNA in vitro Polimerase Chain Reaction – Reação em cadeia da Polimerase Amplificação in vitro de moléculas de DNA – In vivo X In vitro X In silico Procedimento análogo à replicação do DNA – Amostra de DNA; 2 primers; DNA polimerase; Tampão; dNTP

16 Etapas da PCR Ciclos da PCR – Separação das fitas 96°C – Anelamento dos primers 60°C – Síntese do DNA 37°C Problema inicial da técnica – Durante a etapa de quebra das pontes de H e separação das fitas (DNA melting) a 96°C, a enzima polimerase era desnaturada e precisava ser acrescentada ciclo a ciclo... – Não permitia automação

17 História da PCR Químico, 1966 – Doutor em bioquímica, 1972 – 2 anos de pós-doutorado numa industria farmacêutica Deixou a academia para escrever ficção científica, foi dono de padaria por dois anos; voltou à indústria 1983 Teve a idéia de utilizar um par de primers para amplificação enquanto voltava para a casa à noite ao lado da namorada Avisou na empresa e deixou-se que ele ficasse trabalhando na PCR, demorou um ano para padronizar a técnica Perdeu a namorada logo depois, mas ganhou o Nobel de química (1993) 1986 utilização da enzima polimerase de Thermus aquaticus – Permitiu finalmente a automação da técnica Controvérsias: Surfista, já foi divorciado 3 vezes, é um dos que acredita que o HIV não causa a AIDS, e diz ter tomado bastante LSD na década de 60/70 e que isso o ajudou a descobrir a afamada técnica! Kary Mullis, 1944 Taq polimerase

18 PCR Sistema de reação: DNA molde (100 ng) Iniciadores (5 M) dNTPs Tampão com MgCL 2 Taq polimerase Protocolo de amplificação: Desnaturação: 95º C Anelamento: 45-60º C Extensão: 72º C

19 Filmes como técnica didática

20 Interlúdio explicativo Prof. Dr. Francisco Prosdocimi

21 Bioquímica + Biomol Enzimas são proteínas, portanto: 1.São formadas por sequências de aminoácidos 2.Derivam de informações dispostas por genes no DNA, que deve ser transcrito e, posteriormente, traduzido 3.Podemos saber a sequência delas, tanto de aminoácidos quanto de nucleotídeos

22

23 >gi| |ref|NM_ | Homo sapiens hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, mRNA GAGGAGGAGCCGCCGAGCAGCCGCCGGAGGACCACGGCTCGCCAGGGCTGCGGAGGACCGACCGTCCCCA CGCCTGCCGCCCCGCGACCCCGACCGCCAGCATGATCGCCGCGCAGCTCCTGGCCTATTACTTCACGGAG CTGAAGGATGACCAGGTCAAAAAGATTGACAAGTATCTCTATGCCATGCGGCTCTCCGATGAAACTCTCA TAGATATCATGACTCGCTTCAGGAAGGAGATGAAGAATGGCCTCTCCCGGGATTTTAATCCAACAGCCAC AGTCAAGATGTTGCCAACATTCGTAAGGTCCATTCCTGATGGCTCTGAAAAGGGAGATTTCATTGCCCTG GATCTTGGTGGGTCTTCCTTTCGAATTCTGCGGGTGCAAGTGAATCATGAGAAAAACCAGAATGTTCACA TGGAGTCCGAGGTTTATGACACCCCAGAGAACATCGTGCACGGCAGTGGAAGCCAGCTTTTTGATCATGT TGCTGAGTGCCTGGGAGATTTCATGGAGAAAAGGAAGATCAAGGACAAGAAGTTACCTGTGGGATTCACG TTTTCTTTTCCTTGCCAACAATCCAAAATAGATGAGGCCATCCTGATCACCTGGACAAAGCGATTTAAAG CGAGCGGAGTGGAAGGAGCAGATGTGGTCAAACTGCTTAACAAAGCCATCAAAAAGCGAGGGGACTATGA TGCCAACATCGTAGCTGTGGTGAATGACACAGTGGGCACCATGATGACCTGTGGCTATGACGACCAGCAC TGTGAAGTCGGCCTGATCATCGGCACTGGCACCAATGCTTGCTACATGGAGGAACTGAGGCACATTGATC TGGTGGAAGGAGACGAGGGGAGGATGTGTATCAATACAGAATGGGGAGCCTTTGGAGACGATGGATCATT AGAAGACATCCGGACAGAGTTTGACAGGGAGATAGACCGGGGATCCCTCAACCCTGGAAAACAGCTGTTT GAGAAGATGGTCAGTGGCATGTACTTGGGAGAGCTGGTTCGACTGATCCTAGTCAAGATGGCCAAGGAGG GCCTCTTATTTGAAGGGCGGATCACCCCGGAGCTGCTCACCCGAGGGAAGTTTAACACCAGTGATGTGTC AGCCATCGAAAAGAATAAGGAAGGCCTCCACAATGCCAAAGAAATCCTGACCCGCCTGGGAGTGGAGCCG TCCGATGATGACTGTGTCTCAGTCCAGCACGTTTGCACCATTGTCTCATTTCGCTCAGCCAACTTGGTGG CTGCCACACTGGGCGCCATCTTGAACCGCCTGCGTGATAACAAGGGCACACCCAGGCTGCGGACCACGGT TGGTGTCGACGGATCTCTTTACAAGACGCACCCACAGTATTCCCGGCGTTTCCACAAGACTCTAAGGCGC TTGGTGCCAGACTCCGATGTGCGCTTCCTCCTCTCGGAGAGTGGCAGCGGCAAGGGGGCTGCCATGGTGA CGGCGGTGGCCTACCGCTTGGCCGAGCAGCACCGGCAGATAGAGGAGACCCTGGCTCATTTCCACCTCAC CAAGGACATGCTGCTGGAGGTGAAGAAGAGGATGCGGGCCGAGATGGAGCTGGGGCTGAGGAAGCAGACG CACAACAATGCCGTGGTTAAGATGCTGCCCTCCTTCGTCCGGAGAACTCCCGACGGGACCGAGAATGGTG ACTTCTTGGCCCTGGATCTTGGAGGAACCAATTTCCGTGTGCTGCTGGTGAAAATCCGTAGTGGGAAAAA GAGAACGGTGGAAATGCACAACAAGATCTACGCCATTCCTATTGAAATCATGCAGGGCACTGGGGAAGAG CTGTTTGATCACATTGTCTCCTGCATCTCTGACTTCTTGGACTACATGGGGATCAAAGGCCCCAGGATGC CTCTGGGCTTCACGTTCTCATTTCCCTGCCAGCAGACGAGTCTGGACGCGGGAATCTTGATCACGTGGAC AAAGGGTTTTAAGGCAACAGACTGCGTGGGCCACGATGTAGTCACCTTACTAAGGGATGCGATAAAAAGG AGAGAGGAATTTGACCTGGACGTGGTGGCTGTGGTCAACGACACAGTGGGCACCATGATGACCTGTGCTT ATGAGGAGCCCACCTGTGAGGTTGGACTCATTGTTGGGACCGGCAGCAATGCCTGCTACATGGAGGAGAT GAAGAACGTGGAGATGGTGGAGGGGGACCAGGGGCAGATGTGCATCAACATGGAGTGGGGGGCCTTTGGG GACAACGGGTGTCTGGATGATATCAGGACACACTACGACAGACTGGTGGACGAATATTCCCTAAATGCTG GGAAACAAAGGTATGAGAAGATGATCAGTGGTATGTACCTGGGTGAAATCGTCCGCAACATCTTAATCGA CTTCACCAAGAAGGGATTCCTCTTCCGAGGGCAGATCTCTGAGACGCTGAAGACCCGGGGCATCTTTGAG ACCAAGTTTCTCTCTCAGATCGAGAGTGACCGATTAGCACTGCTCCAGGTCCGGGCTATCCTCCAGCAGC TAGGTCTGAATAGCACCTGCGATGACAGTATCCTCGTCAAGACAGTGTGCGGGGTGGTGTCCAGGAGGGC CGCACAGCTGTGTGGCGCAGGCATGGCTGCGGTTGTGGATAAGATCCGCGAGAACAGAGGACTGGACCGT CTGAATGTGACTGTGGGAGTGGACGGGACACTCTACAAGCTTCATCCACACTTCTCCAGAATCATGCACC AGACGGTGAAGGAACTGTCACCAAAATGTAACGTGTCCTTCCTCCTGTCTGAGGATGGCAGCGGCAAGGG GGCCGCCCTCATCACGGCCGTGGGCGTGCGGTTACGCACAGAGGCAAGCAGCTAAGAGTCCGGGATCCCC AGCCTACTGCCTCTCCAGCACTTCTCTCTTCAAGCGGCGACCCCCTACCCTCCCAGCGAGTTGCGCTGGG AGACGCTGGCGCCAGGGCCTGCCGGCGCGGGGAGGAAAGCAAAATCCAACTAATGGTATATATTGTAGGG TACAGAATAGAGCGTGTGCTGTTGATAATATCTCTCACCCGGATCCCTCCTCACTTGCCCTGCCACTTTG CATGGTTTGATTTTGACCTGGTCCCCCACGTGTGAAGTGTAGTGGCATCCATTTCTAATGTATGCATTCA TCCAACAGAGTTATTTATTGGCTGGAGATGGAAAATCACACCACCTGACAGGCCTTCTGGGCCTCCAAAG CCCATCCTTGGGGTTCCCCCTCCCTGTGTGAAATGTATTATCACCAGCAGACACTGCCGGGCCTCCCTCC CGGGGGCACTGCCTGAAGGCGAGTGTGGGCATAGCATTAGCTGCTTCCTCCCCTCCTGGCACCCACTGTG GCCTGGCATCGCATCGTGGTGTGTCAATGCCACAAAATCGTGTGTCCGTGGAACCAGTCCTAGCCGCGTG TGACAGTCTTGCATTCTGTTTGTCTCGTGGGGGGAGGTGGACAGTCCTGCGGAAATGTGTCTTGTCTCCA TTTGGATAAAAGGAACCAACCAACAAACAATGCCATCACTGGAATTTCCCACCGCTTTGTGAGCCGTGTC GTATGACCTAGTAAACTTTGTACCAATTCAAAAAAAAAAAAAAAAAA >gi| |ref|NP_ | hexokinase 1 isoform HKI [Homo sapiens] MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRS IPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEK RKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDT VGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRE IDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLH NAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKR MRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVG HDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQ GQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRG QISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVR LRTEASS 917 aminoácidos 3617 bp 3,6 kb 917 x 3 = = 866

24 Sequenciamento de proteínas Degradação de Edman – Quebra-se o aminoácido N-terminal – Identifica-se o aminoácido quebrado – Sequenciamento de 50 a 70 aas Espectometria de massa – Quebra-se a proteína em diversos pontos e verifica-se a massa dos fragmentos – Comparações com massas conhecidas dos aas identifica a sequência dos mesmos Técnicas com limite de automação – Não permitem produzir dados em larga- escala – Para saber-se a sequência de um proteína, muitas vezes sequencia-se o DNA do organismo de interesse

25 O Sequenciamento de moléculas de DNA Prof. Dr. Francisco Prosdocimi >gi| |gb|BC | Homo sapiens hexokinase 1, mRNA (cDNA clone MGC:1724 IMAGE: ), complete cds GGCTGCGGAGGACCGACCGTCCCCACGCCTGCCGCCCCGCGACCCCGACCGCCAGCATGATCGCCGCGCA GCTCCTGGCCTATTACTTCACGGAGCTGAAGGATGACCAGGTCAAAAAGATTGACAAGTATCTGTATGCC ATGCGGCTCTCCGATGAAACTCTCATAGATATCATGACTCGCTTCAGGAAGGAGATGAAGAATGGCCTCT CCCGGGATTTTAATCCAACAGCCACAGTCAAGATGTTGCCAACATTCGTAAGGTCCATTCCTGATGGCTC TGAAAAGGGAGATTTCATTGCCCTGGATCTTGGTGGGTCTTCCTTTCGAATTCTGCGGGTGCAAGTGAAT CATGAGAAAAACCAGAATGTTCACATGGAGTCCGAGGTTTATGACACCCCAGAGAACATCGTGCACGGCA GTGGAAGCCAGCTTTTTGATCATGTTGCTGAGTGCCTGGGAGATTTCATGGAGAAAAGGAAGATCAAGGA CAAGAAGTTACCTGTGGGATTCACGTTTTCTTTTCCTTGCCAACAATCCAAAATAGATGAGGCCATCCTG ATCACCTGGACAAAGCGATTTAAAGCGAGCGGAGTGGAAGGAGCAGATGTGGTCAAACTGCTTAACAAAG(...) TGACAGGCCTTCTGGGCCTCCAAAGCCCATCCTTGGGGTTCCCCCTCCCTGTGTGAAATGTATTATCACC AGCAGACACTGCCGGGCCTCCCTCCCGGGGGCACTGCCTGAAGGCGAGTGTGGGCATAGCATTAGCTGCT TCCTCCCCTCCTGGCACCCACTGTGGCCTGGCATCGCATCGTGGTGTGTCAATGCCACAAAATCGTGTGT CCGTGGAACCAGTCCTAGCCGCGTGTGACAGTCTTGCATTCTGTTTGTCTCGTGGGGGGAGGTGGACAGT CCTGCGGAAATGTGTCTTGTCTCCATTTGGATAAAAGGAACCAACCAACAAACAATGCCATCACTGGAAT TTCCCACCGCTTTGTGAGCCGTGTCGTATGACCTAGTAAACTTTGTACCAATTCAAAAAAAAAAAAAAAAAA

26 Frederick Sanger Único vivo dentre os 4 indivíduos que já venceram dois prêmios Nobel ~1955: publicou a primeira sequência de aminoácidos da insulina – Ganhou o Nobel de química em : descobriu que as proteínas de bactéria iniciavam-se com o aminoácido formil-metionina 1967: desvendou a sequência do RNA ribossomal 5S 1975: inventou o método dideóxi para o sequenciamento do DNA 1977: sequencia, pela primeira vez, o genoma inteiro de um organismo, o bacteriófago phi X 174 – 11 genes in 5386 bases sequenciadas à mão – Ganha o segundo Nobel de química em 1980

27 O método de Sanger, 1975 Polimerização do DNA a ser sequenciado (molde) na presença de: DNA polimerase primer tampão dNTPs (desóxinucleotídeo) ddNTPs (didesóxinucleotídeo) O que faria um nucleotídeo que, ao invés da extremidade 3OH, tem uma extremidade 3H? Como acontece a síntese de moléculas de DNA? 4LSfecM4&feature=relatedhttp://www.youtube.com/watch?v=Mz- 4LSfecM4&feature=related (dideóxi)

28 Amplificação interrompida com didesoxinucleotídeos O didesóxinucleotídeo não tem a extremidade 3OH livre (...) e, portanto, não permite a incorporação de novas bases a 3 quando é adicionado, (...) interrompendo a formação da nova cadeia definitivamente Desoxinucleotídeos dNTP ddNTP Didesoxinucleotídeos

29 TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA ||||||| 53 ATGCTTC 53 A A A A A A A A A A T T T T T T T T T T TGG G G G G G G G C C C C C C C C C C C

30 TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA ||||||||| 53 ATGCTTC 53A A A A A A A A A A T T T T T T T T T T T G G G G G G G G G C C C C C C C C C C C

31 TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA |||||||||| 3 ATGCTTCTG 53A A A A AA A A A A T T T T T T T T T T T G G G G G G G G G C C C C C C C C C C C

32 TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA ||||||||||||||||| 53 ATGCTTCTGGCAGATCT 53A A A A A A A A A A T T T T T T T T T T T G G G G G G G G G C C C C C C C C C C C

33 TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA ||||||||||||||| 53 ATGCTTCTGGCAGAT 53A A A A A A A A A A T T T T T T T T T T T G G G G G G G G G C C C C C C C C C C C

34 TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA ||||||||||||||| 53 ATGCTTCTGGCAGAT 53A A A A A A A A A A T T T T T T T T TT T G G G G GG G G G C C C C C C C C C C C

35 TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA ||||||||||||||| 53 ATGCTTCTGGCAGAT 53A A A A A A A A A A T T T T T T T T T T T G G G G G G G G G C C C C C C C C C C C

36 ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT 53 ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT ATGCTTCTGGCAGATCTGAACAGTGTTACT ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT ATGCTTCT ATGCTTCTGGCAGATCT TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA |||||||||||||||||||||||||||||||||||||||| 53 ATGCTTCTGGCAGAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTT População de moléculas Incorporação aleatória do didesóxi Quantidade precisa entre didesóxi e desóxi

37 ATGCTTCTGGCAGAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT ATGCTTCTGGCAGATCTGAACAGTGTTACT ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT ATGCTTCT ATGCTTCTGGCAGATCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTT

38 GATC molde molde polimerase polimerase dNTPs dNTPs ddGTPsddGTPs ddATPsddATPs ddTTPsddTTPs ddCTPsddCTPs

39 ATGCTTCTGGCAGAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT ATGCTTCTGGCAGATCTGAACAGTGTTACT ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT ATGCTTCT ATGCTTCTGGCAGATCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTT ATGCTTCTG ATGCTTCTGG ATGCTTCTGGCAG ATGCTTCTGGCAGATCTG ATGCTTCTGGCAGATCTGAACAG ATGCTTCTGGCAGATCTGAACAGTG ATGCTTCTGGCAGATCTGAACAGTGTTACTG ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTG ATGCTTCTGGC ATGCTTCTGGCAGATC ATGCTTCTGGCAGATCTGAAC ATGCTTCTGGCAGATCTGAACAGTGTTAC ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGC ATGCTTCTGGCA ATGCTTCTGGCAGA ATGCTTCTGGCAGATCTGA ATGCTTCTGGCAGATCTGAA ATGCTTCTGGCAGATCTGAACA ATGCTTCTGGCAGATCTGAACAGTGTTA ATGCTTCTGGCAGATCTGAACAGTGTTACTGA ATGCTTCTGGCAGATCTGAACAGTGTTACTGATA GATC

40 ATGCTTCTGGCAGAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT ATGCTTCTGGCAGATCTGAACAGTGTTACT ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT ATGCTTCT ATGCTTCTGGCAGATCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTT ATGCTTCTG ATGCTTCTGG ATGCTTCTGGCAG ATGCTTCTGGCAGATCTG ATGCTTCTGGCAGATCTGAACAG ATGCTTCTGGCAGATCTGAACAGTG ATGCTTCTGGCAGATCTGAACAGTGTTACTG ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTG ATGCTTCTGGC ATGCTTCTGGCAGATC ATGCTTCTGGCAGATCTGAAC ATGCTTCTGGCAGATCTGAACAGTGTTAC ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGC ATGCTTCTGGCA ATGCTTCTGGCAGA ATGCTTCTGGCAGATCTGA ATGCTTCTGGCAGATCTGAA ATGCTTCTGGCAGATCTGAACA ATGCTTCTGGCAGATCTGAACAGTGTTA ATGCTTCTGGCAGATCTGAACAGTGTTACTGA ATGCTTCTGGCAGATCTGAACAGTGTTACTGATA

41

42 Modelo original Marcação do primer 4 reações necessárias, uma para cada base Eletroforese separa fragmentos de diferentes tamanhos Leitura manual da sequência de baixo pra cima Etapa 1 Amplificação Tipo-PCr Etapa 2 Eletroforese

43 Sanger e o fago Phi 174 De fato, esse tipo de sequenciamento manual continuou acontecendo por décadas...

44 Modelo moderno Applied Byosystems, 1986 Marcação fluorescente do ddNTP 1 reação necessária, todas as bases lidas ao mesmo tempo Eletroforese separa fragmentos de diferentes tamanhos Leitura da automática sequência, de baixo pra cima, por um laser ?v=ezAefHhvecM Leroy Hood, 1938-

45 Cromatograma

46 As máquinas necessárias para o sequenciamento Primeira etapa: junta-se os reagentes em poços de placas e coloca-se na máquina de PCR para a reação de amplificação interrompida Diferenças com relação ao PCR – Utilização de um só primer – Utilização dos ddNTPs Uma vez prontas, as sequências de diferentes tamanhos contendo os didesóxi amplificados devem ser enviadas ao sequenciador de DNA mais próximo

47 O que faz um sequenciador de DNA? Segunda etapa: realiza a eletroforese capilar – O sequenciador executa a eletroforese em géis capilares ultra-finos – Um sensor é responsável por emitir um laser e verificar qual o comprimento de onda emitido pelo didesóxi

48

49 Exercício Dê a sequência de DNA da canaleta apontada azul = Guanina amarelo = Timina vermelha = Adenina verde = Citosina ature=related


Carregar ppt "A técnica da Eletroforese para a análise de DNA e proteínas Prof. Dr. Francisco Prosdocimi."

Apresentações semelhantes


Anúncios Google